SCOPe 2.03: Domain d2hdva_: 2hdv A:

Lineage for d2hdva_ (2hdv A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.1: SH2 domain [55551] (35 proteins)
   Pfam PF00017

6. Protein automated matches [190202] (2 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187800] (4 PDB entries)

8. Domain d2hdva_: 2hdv A: [165054]
   automated match to d1rpyb_

Details for d2hdva_

PDB Entry: 2hdv, 2 Å

PDB Description: crystal structure of the src homology-2 domain of the adapter protein sh2-b

PDB Compounds: (A:) SH2-B PH domain containing signaling mediator 1 gamma isoform

SCOPe Domain Sequences for d2hdva_:

Sequence, based on SEQRES records:

>d2hdva_ d.93.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
sdqplsgypwfhgmlsrlkaaqlvleggtgshgvflvrqsetrrgecvltfnfqgkakhl
rlslnaagqcrvqhlhfqsifdmlehfrvhpiplesggssdvvlvsyvps

Sequence, based on observed residues (ATOM records):

>d2hdva_ d.93.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
sdqplsgypwfhgmlsrlkaaqlvleggtgshgvflvrqsetrrgecvltfnfqgkakhl
rlslnaagqcrvqhlhfqsifdmlehfrvhpipdvvlvsyvps

Timeline for d2hdva_:

• d2hdva_ first appeared in SCOPe 2.01
  
• d2hdva_ appears in SCOPe 2.02
  
• d2hdva_ appears in SCOPe 2.04
  
• d2hdva_ appears in the current release, SCOPe 2.08, called d2hdva1