Lineage for d1fz7f_ (1fz7 F:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 2194Fold a.23: Open three-helical up-and-down bundle [47143] (4 superfamilies)
  4. 2214Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family) (S)
  5. 2215Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (1 protein)
  6. 2216Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species)
  7. 2217Species Methylococcus capsulatus [TaxId:414] [47155] (10 PDB entries)
  8. 2227Domain d1fz7f_: 1fz7 F: [16505]
    Other proteins in same PDB: d1fz7a_, d1fz7b_, d1fz7c_, d1fz7d_

Details for d1fz7f_

PDB Entry: 1fz7 (more details), 1.96 Å

PDB Description: methane monooxygenase hydroxylase, form iii soaked in 0.9 m ethanol

SCOP Domain Sequences for d1fz7f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fz7f_ a.23.3.1 (F:) Methane monooxygenase hydrolase, gamma subunit {Methylococcus capsulatus}
lgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieakleek
vavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppim
pvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvhlqsph

SCOP Domain Coordinates for d1fz7f_:

Click to download the PDB-style file with coordinates for d1fz7f_.
(The format of our PDB-style files is described here.)

Timeline for d1fz7f_: