Lineage for d1fz7e_ (1fz7 E:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 637810Fold a.23: Open three-helical up-and-down bundle [47143] (6 superfamilies)
    core: 3 helices; bundle, open
  4. 637841Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family) (S)
    duplication: consists of two domains of this fold
  5. 637842Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (1 protein)
  6. 637843Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species)
  7. 637844Species Methylococcus capsulatus [TaxId:414] [47155] (26 PDB entries)
  8. 637857Domain d1fz7e_: 1fz7 E: [16504]
    Other proteins in same PDB: d1fz7a_, d1fz7b_, d1fz7c_, d1fz7d_

Details for d1fz7e_

PDB Entry: 1fz7 (more details), 1.96 Å

PDB Description: methane monooxygenase hydroxylase, form iii soaked in 0.9 m ethanol
PDB Compounds: (E:) methane monooxygenase component a, gamma chain

SCOP Domain Sequences for d1fz7e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fz7e_ a.23.3.1 (E:) Methane monooxygenase hydrolase, gamma subunit {Methylococcus capsulatus [TaxId: 414]}
klgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieaklee
kvavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppi
mpvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvhlqs

SCOP Domain Coordinates for d1fz7e_:

Click to download the PDB-style file with coordinates for d1fz7e_.
(The format of our PDB-style files is described here.)

Timeline for d1fz7e_: