Class b: All beta proteins [48724] (174 folds) |
Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
Superfamily b.50.1: Acid proteases [50630] (4 families) |
Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins) dimer of identical mono-domain chains, each containing (6,10) barrel |
Protein automated matches [190433] (10 species) not a true protein |
Species Feline immunodeficiency virus (isolate petaluma) [TaxId:11674] [187795] (1 PDB entry) |
Domain d2haha_: 2hah A: [165035] automated match to d1b11a_ complexed with 3tl |
PDB Entry: 2hah (more details), 1.7 Å
SCOPe Domain Sequences for d2haha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2haha_ b.50.1.1 (A:) automated matches {Feline immunodeficiency virus (isolate petaluma) [TaxId: 11674]} gttttlekrpeilifvngypikflldtgaditvlnrrdfqvknsiengrqmiggiggfir gtnyinvhleirdenyktqcifgnvcvlednstpvnilgrdnmikfnirlvm
Timeline for d2haha_: