Lineage for d2haha_ (2hah A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 955287Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 955288Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 955289Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 956189Protein automated matches [190433] (10 species)
    not a true protein
  7. 956190Species Feline immunodeficiency virus (isolate petaluma) [TaxId:11674] [187795] (1 PDB entry)
  8. 956191Domain d2haha_: 2hah A: [165035]
    automated match to d1b11a_
    complexed with 3tl

Details for d2haha_

PDB Entry: 2hah (more details), 1.7 Å

PDB Description: the structure of fiv 12s protease in complex with tl-3
PDB Compounds: (A:) Protease

SCOPe Domain Sequences for d2haha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2haha_ b.50.1.1 (A:) automated matches {Feline immunodeficiency virus (isolate petaluma) [TaxId: 11674]}
gttttlekrpeilifvngypikflldtgaditvlnrrdfqvknsiengrqmiggiggfir
gtnyinvhleirdenyktqcifgnvcvlednstpvnilgrdnmikfnirlvm

SCOPe Domain Coordinates for d2haha_:

Click to download the PDB-style file with coordinates for d2haha_.
(The format of our PDB-style files is described here.)

Timeline for d2haha_: