SCOPe 2.08: Domain d2h9wa1: 2h9w A:1002-1237

Lineage for d2h9wa1 (2h9w A:1002-1237)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein Green fluorescent protein, GFP [54513] (6 species)

7. Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (285 PDB entries)
   Uniprot P42212

8. Domain d2h9wa1: 2h9w A:1002-1237 [165026]
   Other proteins in same PDB: d2h9wa2
   automated match to d1qyoa_
   complexed with so4

Details for d2h9wa1

PDB Entry: 2h9w, 1.82 Å

PDB Description: green fluorescent protein ground states: the influence of a second protonation site near the chromophore

PDB Compounds: (A:) Green fluorescent protein

SCOPe Domain Sequences for d2h9wa1:

Sequence; same for both SEQRES and ATOM records:

>d2h9wa1 d.22.1.1 (A:1002-1237) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
skgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlv
ttlgygvqcfsrypdhmkqhdffksampegyvqertiffkddgnyktraevkfegdtlvn
rielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqladh
yqqntpigdgpvllpdnhylsyqsalskdpnekrdhmvllefvtaagitlgmdely

Timeline for d2h9wa1:

• d2h9wa1 first appeared in SCOPe 2.01, called d2h9wa_
  
• d2h9wa1 appears in SCOPe 2.07