| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.68: IF3-like [55199] (8 superfamilies) beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest |
Superfamily d.68.6: AlbA-like [82704] (3 families) ![]() |
| Family d.68.6.0: automated matches [191549] (1 protein) not a true family |
| Protein automated matches [190948] (3 species) not a true protein |
| Species Aeropyrum pernix [TaxId:272557] [188545] (2 PDB entries) |
| Domain d2h9ua_: 2h9u A: [165025] automated match to d1nfha_ complexed with edo |
PDB Entry: 2h9u (more details), 2 Å
SCOPe Domain Sequences for d2h9ua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h9ua_ d.68.6.0 (A:) automated matches {Aeropyrum pernix [TaxId: 272557]}
acegapevrigrkpvmnyvlailttlmeqgtnqvvvkargrninravdaveivrkrfakn
ieikdikidsqeievqtpegqtrtrrvssieiclekagesa
Timeline for d2h9ua_: