Lineage for d2h9mc_ (2h9m C:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1803012Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 1803160Superfamily b.69.4: WD40 repeat-like [50978] (4 families) (S)
    also contains 8-bladed propellers
  5. 1803303Family b.69.4.0: automated matches [191412] (1 protein)
    not a true family
  6. 1803304Protein automated matches [190568] (5 species)
    not a true protein
  7. 1803323Species Human (Homo sapiens) [TaxId:9606] [187559] (43 PDB entries)
  8. 1803355Domain d2h9mc_: 2h9m C: [165022]
    automated match to d1vyhc1

Details for d2h9mc_

PDB Entry: 2h9m (more details), 1.9 Å

PDB Description: WDR5 in complex with unmodified H3K4 peptide
PDB Compounds: (C:) wd-repeat protein 5

SCOPe Domain Sequences for d2h9mc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h9mc_ b.69.4.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vkpnyalkftlaghtkavssvkfspngewlasssadklikiwgaydgkfektisghklgi
sdvawssdsnllvsasddktlkiwdvssgkclktlkghsnyvfccnfnpqsnlivsgsfd
esvriwdvktgkclktlpahsdpvsavhfnrdgslivsssydglcriwdtasgqclktli
dddnppvsfvkfspngkyilaatldntlklwdyskgkclktytghknekycifanfsvtg
gkwivsgsednlvyiwnlqtkeivqklqghtdvvistachpteniiasaalendktiklw
ksdc

SCOPe Domain Coordinates for d2h9mc_:

Click to download the PDB-style file with coordinates for d2h9mc_.
(The format of our PDB-style files is described here.)

Timeline for d2h9mc_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2h9ma_