| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins) parallel beta-sheet of 5 strands, order 23145 |
| Protein CMP kinase [52548] (3 species) |
| Species Staphylococcus aureus [TaxId:1280] [187794] (1 PDB entry) |
| Domain d2h92c_: 2h92 C: [165020] automated match to d1q3ta_ complexed with c5p, pg4, so4 |
PDB Entry: 2h92 (more details), 2.3 Å
SCOPe Domain Sequences for d2h92c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h92c_ c.37.1.1 (C:) CMP kinase {Staphylococcus aureus [TaxId: 1280]}
ainialdgpaaagkstiakrvaselsmiyvdtgamyraltykylklnktedfaklvdqtt
ldltykadkgqcvildnedvtdflrnndvtqhvsyvaskepvrsfavkkqkelaaekgiv
mdgrdigtvvlpdadlkvymiasveeraerrykdnqlrgiesnfedlkrdieardqydmn
reisplrkaddavtldttgksieevtdeilamvsqi
Timeline for d2h92c_: