Lineage for d2h92c_ (2h92 C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2865685Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 2865762Protein CMP kinase [52548] (3 species)
  7. 2865776Species Staphylococcus aureus [TaxId:1280] [187794] (1 PDB entry)
  8. 2865779Domain d2h92c_: 2h92 C: [165020]
    automated match to d1q3ta_
    complexed with c5p, pg4, so4

Details for d2h92c_

PDB Entry: 2h92 (more details), 2.3 Å

PDB Description: Crystal Structure of Staphylococcus aureus Cytidine Monophosphate Kinase in complex with cytidine-5'-monophosphate
PDB Compounds: (C:) Cytidylate kinase

SCOPe Domain Sequences for d2h92c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h92c_ c.37.1.1 (C:) CMP kinase {Staphylococcus aureus [TaxId: 1280]}
ainialdgpaaagkstiakrvaselsmiyvdtgamyraltykylklnktedfaklvdqtt
ldltykadkgqcvildnedvtdflrnndvtqhvsyvaskepvrsfavkkqkelaaekgiv
mdgrdigtvvlpdadlkvymiasveeraerrykdnqlrgiesnfedlkrdieardqydmn
reisplrkaddavtldttgksieevtdeilamvsqi

SCOPe Domain Coordinates for d2h92c_:

Click to download the PDB-style file with coordinates for d2h92c_.
(The format of our PDB-style files is described here.)

Timeline for d2h92c_: