Class a: All alpha proteins [46456] (284 folds) |
Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies) core: 3 helices; bundle, open |
Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family) duplication: consists of two domains of this fold |
Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (1 protein) |
Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species) |
Species Methylococcus capsulatus [TaxId:414] [47155] (26 PDB entries) |
Domain d1fz3e_: 1fz3 E: [16502] Other proteins in same PDB: d1fz3a_, d1fz3b_, d1fz3c_, d1fz3d_ |
PDB Entry: 1fz3 (more details), 2.03 Å
SCOP Domain Sequences for d1fz3e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fz3e_ a.23.3.1 (E:) Methane monooxygenase hydrolase, gamma subunit {Methylococcus capsulatus [TaxId: 414]} klgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieaklee kvavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppi mpvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvhlqs
Timeline for d1fz3e_: