Lineage for d1fz3e_ (1fz3 E:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 2194Fold a.23: Open three-helical up-and-down bundle [47143] (4 superfamilies)
  4. 2214Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family) (S)
  5. 2215Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (1 protein)
  6. 2216Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species)
  7. 2217Species Methylococcus capsulatus [TaxId:414] [47155] (10 PDB entries)
  8. 2224Domain d1fz3e_: 1fz3 E: [16502]
    Other proteins in same PDB: d1fz3a_, d1fz3b_, d1fz3c_, d1fz3d_

Details for d1fz3e_

PDB Entry: 1fz3 (more details), 2.03 Å

PDB Description: methane monooxygenase hydroxylase, form iii soak at ph 6.2 (0.1 m pipes)

SCOP Domain Sequences for d1fz3e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fz3e_ a.23.3.1 (E:) Methane monooxygenase hydrolase, gamma subunit {Methylococcus capsulatus}
klgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieaklee
kvavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppi
mpvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvhlqs

SCOP Domain Coordinates for d1fz3e_:

Click to download the PDB-style file with coordinates for d1fz3e_.
(The format of our PDB-style files is described here.)

Timeline for d1fz3e_: