SCOPe 2.06: Domain d2h92b_: 2h92 B:

Lineage for d2h92b_ (2h92 B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
   parallel beta-sheet of 5 strands, order 23145

6. Protein CMP kinase [52548] (3 species)

7. Species Staphylococcus aureus [TaxId:1280] [187794] (1 PDB entry)

8. Domain d2h92b_: 2h92 B: [165019]
   automated match to d1q3ta_
   complexed with c5p, pg4, so4

Details for d2h92b_

PDB Entry: 2h92, 2.3 Å

PDB Description: Crystal Structure of Staphylococcus aureus Cytidine Monophosphate Kinase in complex with cytidine-5'-monophosphate

PDB Compounds: (B:) Cytidylate kinase

SCOPe Domain Sequences for d2h92b_:

Sequence; same for both SEQRES and ATOM records:

>d2h92b_ c.37.1.1 (B:) CMP kinase {Staphylococcus aureus [TaxId: 1280]}
ainialdgpaaagkstiakrvaselsmiyvdtgamyraltykylklnktedfaklvdqtt
ldltykadkgqcvildnedvtdflrnndvtqhvsyvaskepvrsfavkkqkelaaekgiv
mdgrdigtvvlpdadlkvymiasveeraerrykdnqlrgiesnfedlkrdieardqydmn
reisplrkaddavtldttgksieevtdeilamvsqi

Timeline for d2h92b_:

• d2h92b_ first appeared in SCOPe 2.01
  
• d2h92b_ appears in SCOPe 2.05
  
• d2h92b_ appears in SCOPe 2.07
  
• d2h92b_ appears in the current release, SCOPe 2.08