SCOPe 2.01: Domain d2h8za_: 2h8z A:

Lineage for d2h8za_ (2h8z A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families)

5. Family c.1.4.0: automated matches [191310] (1 protein)
   not a true family

6. Protein automated matches [190048] (11 species)
   not a true protein

7. Species Pseudomonas putida [TaxId:303] [187793] (12 PDB entries)

8. Domain d2h8za_: 2h8z A: [165016]
   automated match to d1z41a1
   complexed with 8cm, fmn, so4

Details for d2h8za_

PDB Entry: 2h8z, 1.42 Å

PDB Description: xenobiotic reductase a in complex with 8-hydroxycoumarin

PDB Compounds: (A:) Xenobiotic reductase A

SCOPe Domain Sequences for d2h8za_:

Sequence; same for both SEQRES and ATOM records:

>d2h8za_ c.1.4.0 (A:) automated matches {Pseudomonas putida [TaxId: 303]}
salfepytlkdvtlrnriaippmcqymaedgmindwhhvhlaglarggagllvveatava
pegritpgcagiwsdahaqafvpvvqaikaagsvpgiqiahagrkasanrpwegddhiaa
ddtrgwetiapsaiafgahlpkvpremtlddiarvkqdfvdaarrardagfewielhfah
gylgqsffsehsnkrtdayggsfdnrsrflletlaavrevwpenlpltarfgvleydgrd
eqtleesielarrfkaggldllsvsvgftipdtnipwgpafmgpiaervrreaklpvtsa
wgfgtpqlaeaalqanqldlvsvgrahladphwayfaakelgvekaswtlpapyahwle

Timeline for d2h8za_:

• d2h8za_ is new in SCOPe 2.01-stable
  
• d2h8za_ appears in SCOPe 2.02
  
• d2h8za_ appears in the current release, SCOPe 2.08