Lineage for d2h8xa_ (2h8x A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 968086Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 969026Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 969327Family c.1.4.0: automated matches [191310] (1 protein)
    not a true family
  6. 969328Protein automated matches [190048] (11 species)
    not a true protein
  7. 969366Species Pseudomonas putida [TaxId:303] [187793] (12 PDB entries)
  8. 969374Domain d2h8xa_: 2h8x A: [165015]
    automated match to d1z41a1
    complexed with fmn, so4

Details for d2h8xa_

PDB Entry: 2h8x (more details), 1.5 Å

PDB Description: xenobiotic reductase a-oxidized
PDB Compounds: (A:) Xenobiotic reductase A

SCOPe Domain Sequences for d2h8xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h8xa_ c.1.4.0 (A:) automated matches {Pseudomonas putida [TaxId: 303]}
alfepytlkdvtlrnriaippmcqymaedgmindwhhvhlaglarggagllvveatavap
egritpgcagiwsdahaqafvpvvqaikaagsvpgiqiahagrkasanrpwegddhiaad
dtrgwetiapsaiafgahlpkvpremtlddiarvkqdfvdaarrardagfewielhfahg
ylgqsffsehsnkrtdayggsfdnrsrflletlaavrevwpenlpltarfgvleydgrde
qtleesielarrfkaggldllsvsvgftipdtnipwgpafmgpiaervrreaklpvtsaw
gfgtpqlaeaalqanqldlvsvgrahladphwayfaakelgvekaswtlpapyahwle

SCOPe Domain Coordinates for d2h8xa_:

Click to download the PDB-style file with coordinates for d2h8xa_.
(The format of our PDB-style files is described here.)

Timeline for d2h8xa_: