SCOPe 2.04: Domain d2h8va_: 2h8v A:

Lineage for d2h8va_ (2h8v A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families)
   the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity

5. Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (6 proteins)
   automatically mapped to Pfam PF01395

6. Protein Pheromone-binding protein asp1 [101192] (1 species)

7. Species Honeybee (Apis mellifera) [TaxId:7460] [101193] (14 PDB entries)

8. Domain d2h8va_: 2h8v A: [165014]
   automated match to d1r5ra_
   complexed with cl, gol, so4

Details for d2h8va_

PDB Entry: 2h8v, 2.6 Å

PDB Description: structure of empty pheromone binding protein asp1 from the honeybee apis mellifera l

PDB Compounds: (A:) Pheromone-binding protein ASP1

SCOPe Domain Sequences for d2h8va_:

Sequence; same for both SEQRES and ATOM records:

>d2h8va_ a.39.2.1 (A:) Pheromone-binding protein asp1 {Honeybee (Apis mellifera) [TaxId: 7460]}
dwvppevfdlvaedkarcmsehgttqaqiddvdkgnlvnepsitcymyclleafslvdde
anvdedimlgllpdqlqeraqsvmgkclptsgsdncnkiynlakcvqesapdvwfvi

Timeline for d2h8va_:

• d2h8va_ first appeared in SCOPe 2.01
  
• d2h8va_ appears in SCOPe 2.03
  
• d2h8va_ appears in SCOPe 2.05
  
• d2h8va_ appears in the current release, SCOPe 2.08