Lineage for d2h8qa_ (2h8q A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2164731Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2164732Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2164733Family d.22.1.1: Fluorescent proteins [54512] (6 protein domains)
  6. 2164997Protein Red fluorescent protein (fp583 or dsred(clontech)) [54515] (1 species)
  7. 2164998Species Coral (Discosoma sp.) [TaxId:86600] [54516] (3 PDB entries)
  8. 2165007Domain d2h8qa_: 2h8q A: [165010]
    automated match to d1g7ka_
    mutant

Details for d2h8qa_

PDB Entry: 2h8q (more details), 2 Å

PDB Description: Crystal Structure of a Redshifted Mutant (K83M) of the Red Fluorescent Protein dRFP583/dsRed
PDB Compounds: (A:) red fluorescent protein drfp583

SCOPe Domain Sequences for d2h8qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h8qa_ d.22.1.1 (A:) Red fluorescent protein (fp583 or dsred(clontech)) {Coral (Discosoma sp.) [TaxId: 86600]}
vikefmrfkvrmegtvnghefeiegegegrpyeghntvklkvtkggplpfawdilspqfq
ygskvyvkhpadipdymklsfpegfkwervmnfedggvvtvtqdsslqdgcfiykvkfig
vnfpsdgpvmqkktmgweasterlyprdgvlkgeihkalklkdgghylvefksiymakkp
vqlpgyyyvdsklditshnedytiveqyertegrhhlfl

SCOPe Domain Coordinates for d2h8qa_:

Click to download the PDB-style file with coordinates for d2h8qa_.
(The format of our PDB-style files is described here.)

Timeline for d2h8qa_: