Lineage for d1fz1f_ (1fz1 F:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2312626Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies)
    core: 3 helices; bundle, open
  4. 2312673Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family) (S)
    duplication: consists of two domains of this fold
    automatically mapped to Pfam PF02964
  5. 2312674Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (2 proteins)
  6. 2312675Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species)
  7. 2312676Species Methylococcus capsulatus [TaxId:414] [47155] (27 PDB entries)
  8. 2312684Domain d1fz1f_: 1fz1 F: [16501]
    Other proteins in same PDB: d1fz1a_, d1fz1b_, d1fz1c_, d1fz1d_
    complexed with ca, fe, fmt

Details for d1fz1f_

PDB Entry: 1fz1 (more details), 1.96 Å

PDB Description: methane monooxygenase hydroxylase, form iii oxidized
PDB Compounds: (F:) methane monooxygenase component a, gamma chain

SCOPe Domain Sequences for d1fz1f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fz1f_ a.23.3.1 (F:) Methane monooxygenase hydrolase, gamma subunit {Methylococcus capsulatus [TaxId: 414]}
klgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieaklee
kvavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppi
mpvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvhlqsph

SCOPe Domain Coordinates for d1fz1f_:

Click to download the PDB-style file with coordinates for d1fz1f_.
(The format of our PDB-style files is described here.)

Timeline for d1fz1f_: