SCOPe 2.07: Domain d2h8ia_: 2h8i A:

Lineage for d2h8ia_ (2h8i A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
   automatically mapped to Pfam PF00068

6. Protein automated matches [190139] (27 species)
   not a true protein

7. Species Jararacussu (Bothrops jararacussu) [TaxId:8726] [186913] (8 PDB entries)

8. Domain d2h8ia_: 2h8i A: [165008]
   automated match to d1pa0a_
   complexed with peg

Details for d2h8ia_

PDB Entry: 2h8i, 1.9 Å

PDB Description: crystal structure of the bothropstoxin-i complexed with polyethylene glycol

PDB Compounds: (A:) Phospholipase A2 homolog 1

SCOPe Domain Sequences for d2h8ia_:

Sequence; same for both SEQRES and ATOM records:

>d2h8ia_ a.133.1.2 (A:) automated matches {Jararacussu (Bothrops jararacussu) [TaxId: 8726]}
slfelgkmilqetgknpaksygaygcncgvlgrgkpkdatdrccyvhkccykkltgcnpk
kdrysyswkdktivcgennpclkelcecdkavaiclrenlgtynkkyryhlkpfckkadp
c

Timeline for d2h8ia_:

• d2h8ia_ first appeared in SCOPe 2.01
  
• d2h8ia_ appears in SCOPe 2.06
  
• d2h8ia_ appears in the current release, SCOPe 2.08