![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
![]() | Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) ![]() |
![]() | Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins) automatically mapped to Pfam PF00068 |
![]() | Protein automated matches [190139] (27 species) not a true protein |
![]() | Species Jararacussu (Bothrops jararacussu) [TaxId:8726] [186913] (8 PDB entries) |
![]() | Domain d2h8ia_: 2h8i A: [165008] automated match to d1pa0a_ complexed with peg |
PDB Entry: 2h8i (more details), 1.9 Å
SCOPe Domain Sequences for d2h8ia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h8ia_ a.133.1.2 (A:) automated matches {Jararacussu (Bothrops jararacussu) [TaxId: 8726]} slfelgkmilqetgknpaksygaygcncgvlgrgkpkdatdrccyvhkccykkltgcnpk kdrysyswkdktivcgennpclkelcecdkavaiclrenlgtynkkyryhlkpfckkadp c
Timeline for d2h8ia_: