SCOP 1.65: Domain d1mtyh_: 1mty H:

Lineage for d1mtyh_ (1mty H:)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.23: Open three-helical up-and-down bundle [47143] (5 superfamilies)
   core: 3 helices; bundle, open

4. Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family)
   duplication: consists of two domains of this fold

5. Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (1 protein)

6. Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species)

7. Species Methylococcus capsulatus [TaxId:414] [47155] (15 PDB entries)

8. Domain d1mtyh_: 1mty H: [16499]
   Other proteins in same PDB: d1mtyb_, d1mtyc_, d1mtyd_, d1mtye_
   complexed with fe

Details for d1mtyh_

PDB Entry: 1mty, 1.7 Å

PDB Description: methane monooxygenase hydroxylase from methylococcus capsulatus (bath)

SCOP Domain Sequences for d1mtyh_:

Sequence; same for both SEQRES and ATOM records:

>d1mtyh_ a.23.3.1 (H:) Methane monooxygenase hydrolase, gamma subunit {Methylococcus capsulatus}
lgihsndtrdawvnkiahvntlekaaemlkqfrmdhttpfrnsyeldndylwieakleek
vavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppim
pvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvh

Timeline for d1mtyh_:

• d1mtyh_ first appeared (with stable ids) in SCOP 1.55
  
• d1mtyh_ appears in SCOP 1.63
  
• d1mtyh_ appears in SCOP 1.67
  
• d1mtyh_ appears in the current release, SCOPe 2.08