Lineage for d1mtyh_ (1mty H:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 2194Fold a.23: Open three-helical up-and-down bundle [47143] (4 superfamilies)
  4. 2214Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family) (S)
  5. 2215Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (1 protein)
  6. 2216Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species)
  7. 2217Species Methylococcus capsulatus [TaxId:414] [47155] (10 PDB entries)
  8. 2219Domain d1mtyh_: 1mty H: [16499]
    Other proteins in same PDB: d1mtyb_, d1mtyc_, d1mtyd_, d1mtye_

Details for d1mtyh_

PDB Entry: 1mty (more details), 1.7 Å

PDB Description: methane monooxygenase hydroxylase from methylococcus capsulatus (bath)

SCOP Domain Sequences for d1mtyh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mtyh_ a.23.3.1 (H:) Methane monooxygenase hydrolase, gamma subunit {Methylococcus capsulatus}
lgihsndtrdawvnkiahvntlekaaemlkqfrmdhttpfrnsyeldndylwieakleek
vavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppim
pvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvh

SCOP Domain Coordinates for d1mtyh_:

Click to download the PDB-style file with coordinates for d1mtyh_.
(The format of our PDB-style files is described here.)

Timeline for d1mtyh_: