Lineage for d2h6ya_ (2h6y A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2876128Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 2876194Protein Thioredoxin [52835] (16 species)
  7. 2876219Species Escherichia coli [TaxId:562] [52836] (55 PDB entries)
    Uniprot P00274 ! Uniprot P00581
  8. 2876282Domain d2h6ya_: 2h6y A: [164984]
    automated match to d1xoaa_
    complexed with mpd; mutant

Details for d2h6ya_

PDB Entry: 2h6y (more details), 2.4 Å

PDB Description: crystal structure of thioredoxin mutant e48d in hexagonal (p61) space group
PDB Compounds: (A:) thioredoxin

SCOPe Domain Sequences for d2h6ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h6ya_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]}
dkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiaddyqgkltvaklnid
qnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla

SCOPe Domain Coordinates for d2h6ya_:

Click to download the PDB-style file with coordinates for d2h6ya_.
(The format of our PDB-style files is described here.)

Timeline for d2h6ya_: