| Class b: All beta proteins [48724] (178 folds) |
| Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) ![]() |
| Family b.3.4.0: automated matches [191441] (1 protein) not a true family |
| Protein automated matches [190651] (8 species) not a true protein |
| Species Zebrafish (Danio rerio) [TaxId:7955] [187781] (5 PDB entries) |
| Domain d2h6ue_: 2h6u E: [164979] automated match to d1tfpa_ |
PDB Entry: 2h6u (more details), 1.7 Å
SCOPe Domain Sequences for d2h6ue_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h6ue_ b.3.4.0 (E:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
lsplsthvlniaqgvpganmtivlhrldpvssawnilttgitnddgrcpglitkenfiag
vykmrfetgkywdalgetcfypyveivftitntsqhyhvplllsrfsystyrgs
Timeline for d2h6ue_: