Lineage for d2h6ub_ (2h6u B:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1301408Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 1301610Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) (S)
  5. 1302081Family b.3.4.0: automated matches [191441] (1 protein)
    not a true family
  6. 1302082Protein automated matches [190651] (6 species)
    not a true protein
  7. 1302112Species Zebrafish (Danio rerio) [TaxId:7955] [187781] (5 PDB entries)
  8. 1302118Domain d2h6ub_: 2h6u B: [164976]
    automated match to d1tfpa_

Details for d2h6ub_

PDB Entry: 2h6u (more details), 1.7 Å

PDB Description: crystal structure of 5-hydroxyisourate hydrolase (formerly known as trp, transthyretin related protein)
PDB Compounds: (B:) 5-hydroxyisourate Hydrolase (formerly known as TRP, Transthyretin Related Protein)

SCOPe Domain Sequences for d2h6ub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h6ub_ b.3.4.0 (B:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
lsplsthvlniaqgvpganmtivlhrldpvssawnilttgitnddgrcpglitkenfiag
vykmrfetgkywdalgetcfypyveivftitntsqhyhvplllsrfsystyrgs

SCOPe Domain Coordinates for d2h6ub_:

Click to download the PDB-style file with coordinates for d2h6ub_.
(The format of our PDB-style files is described here.)

Timeline for d2h6ub_: