SCOPe 2.02: Domain d2h6ua_: 2h6u A:

Lineage for d2h6ua_ (2h6u A:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families)

5. Family b.3.4.0: automated matches [191441] (1 protein)
   not a true family

6. Protein automated matches [190651] (6 species)
   not a true protein

7. Species Zebrafish (Danio rerio) [TaxId:7955] [187781] (3 PDB entries)

8. Domain d2h6ua_: 2h6u A: [164975]
   automated match to d1tfpa_

Details for d2h6ua_

PDB Entry: 2h6u, 1.7 Å

PDB Description: crystal structure of 5-hydroxyisourate hydrolase (formerly known as trp, transthyretin related protein)

PDB Compounds: (A:) 5-hydroxyisourate Hydrolase (formerly known as TRP, Transthyretin Related Protein)

SCOPe Domain Sequences for d2h6ua_:

Sequence; same for both SEQRES and ATOM records:

>d2h6ua_ b.3.4.0 (A:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
lsplsthvlniaqgvpganmtivlhrldpvssawnilttgitnddgrcpglitkenfiag
vykmrfetgkywdalgetcfypyveivftitntsqhyhvplllsrfsystyrgs

Timeline for d2h6ua_:

• d2h6ua_ first appeared in SCOPe 2.01
  
• d2h6ua_ appears in SCOPe 2.03
  
• d2h6ua_ appears in the current release, SCOPe 2.08