Lineage for d2h6rg_ (2h6r G:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 968086Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 968087Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 968088Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein)
  6. 968089Protein Triosephosphate isomerase [51353] (20 species)
  7. 968208Species Methanocaldococcus jannaschii [TaxId:243232] [187790] (1 PDB entry)
  8. 968215Domain d2h6rg_: 2h6r G: [164972]
    automated match to d1hg3a_

Details for d2h6rg_

PDB Entry: 2h6r (more details), 2.3 Å

PDB Description: Crystal Structure of triosephosphate isomerase (TIM) from Methanocaldococcus jannaschii
PDB Compounds: (G:) triosephosphate isomerase

SCOPe Domain Sequences for d2h6rg_:

Sequence, based on SEQRES records: (download)

>d2h6rg_ c.1.1.1 (G:) Triosephosphate isomerase {Methanocaldococcus jannaschii [TaxId: 243232]}
mvivinyktynesignrgleiakiaekvseesgitigvapqfvdlrmivenvnipvyaqh
idninpgshtghilaeaikdcgckgtlinhsekrmlladieavinkcknlgletivctnn
intskavaalspdciaveppeligtgipvskanpevvegtvravkeinkdvkvlcgagis
kgedvkaaldlgaegvllasgvvkaknveeairelik

Sequence, based on observed residues (ATOM records): (download)

>d2h6rg_ c.1.1.1 (G:) Triosephosphate isomerase {Methanocaldococcus jannaschii [TaxId: 243232]}
mvivinyktynesignrgleiakiaekvseesgitigvapqfvdlrmivenvnipvyaqh
idninpgshtghilaeaikdcgckgtlinhsekrmlladieavinkcknlgletivctnn
intskavaalspdciaveppegtvravkeinkdvkvlcgagiskgedvkaaldlgaegvl
lasgvvkaknveeairelik

SCOPe Domain Coordinates for d2h6rg_:

Click to download the PDB-style file with coordinates for d2h6rg_.
(The format of our PDB-style files is described here.)

Timeline for d2h6rg_: