Lineage for d2h6ra_ (2h6r A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2078561Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 2078562Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 protein domains)
    automatically mapped to Pfam PF00121
  6. 2078563Protein Triosephosphate isomerase [51353] (20 species)
  7. 2078705Species Methanocaldococcus jannaschii [TaxId:243232] [187790] (1 PDB entry)
  8. 2078706Domain d2h6ra_: 2h6r A: [164966]
    automated match to d1hg3a_

Details for d2h6ra_

PDB Entry: 2h6r (more details), 2.3 Å

PDB Description: Crystal Structure of triosephosphate isomerase (TIM) from Methanocaldococcus jannaschii
PDB Compounds: (A:) triosephosphate isomerase

SCOPe Domain Sequences for d2h6ra_:

Sequence, based on SEQRES records: (download)

>d2h6ra_ c.1.1.1 (A:) Triosephosphate isomerase {Methanocaldococcus jannaschii [TaxId: 243232]}
mvivinyktynesignrgleiakiaekvseesgitigvapqfvdlrmivenvnipvyaqh
idninpgshtghilaeaikdcgckgtlinhsekrmlladieavinkcknlgletivctnn
intskavaalspdciaveppeligtgipvskanpevvegtvravkeinkdvkvlcgagis
kgedvkaaldlgaegvllasgvvkaknveeairelik

Sequence, based on observed residues (ATOM records): (download)

>d2h6ra_ c.1.1.1 (A:) Triosephosphate isomerase {Methanocaldococcus jannaschii [TaxId: 243232]}
mvivinyktynesignrgleiakiaekvseesgitigvapqfvdlrmivenvnipvyaqh
idninpgshtghilaeaikdcgckgtlinhsekrmlladieavinkcknlgletivctnn
intskavaalspdciaveppevvegtvravkeinkdvkvlcgagiskgedvkaaldlgae
gvllasgvvkaknveeairelik

SCOPe Domain Coordinates for d2h6ra_:

Click to download the PDB-style file with coordinates for d2h6ra_.
(The format of our PDB-style files is described here.)

Timeline for d2h6ra_: