SCOPe 2.01: Domain d2h6kb_: 2h6k B:

Lineage for d2h6kb_ (2h6k B:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
   consists of seven 4-stranded beta-sheet motifs; meander

4. Superfamily b.69.4: WD40 repeat-like [50978] (3 families)
   also contains 8-bladed propellers

5. Family b.69.4.0: automated matches [191412] (1 protein)
   not a true family

6. Protein automated matches [190568] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187559] (26 PDB entries)

8. Domain d2h6kb_: 2h6k B: [164961]
   automated match to d1vyhc1

Details for d2h6kb_

PDB Entry: 2h6k, 1.89 Å

PDB Description: Histone H3 recognition and presentation by the WDR5 module of the MLL1 complex

PDB Compounds: (B:) wd-repeat protein 5

SCOPe Domain Sequences for d2h6kb_:

Sequence; same for both SEQRES and ATOM records:

>d2h6kb_ b.69.4.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tpvkpnyalkftlaghtkavssvkfspngewlasssadklikiwgaydgkfektisghkl
gisdvawssdsnllvsasddktlkiwdvssgkclktlkghsnyvfccnfnpqsnlivsgs
fdesvriwdvktgkclktlpahsdpvsavhfnrdgslivsssydglcriwdtasgqclkt
lidddnppvsfvkfspngkyilaatldntlklwdyskgkclktytghknekycifanfsv
tggkwivsgsednlvyiwnlqtkeivqklqghtdvvistachpteniiasaalendktik
lwksdc

Timeline for d2h6kb_:

• d2h6kb_ is new in SCOPe 2.01-stable
  
• d2h6kb_ appears in SCOPe 2.02
  
• d2h6kb_ appears in the current release, SCOPe 2.08