Lineage for d1diog_ (1dio G:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 46401Fold a.23: Open three-helical up-and-down bundle [47143] (4 superfamilies)
  4. 46409Superfamily a.23.2: Diol dehydratase, gamma subunit [47148] (1 family) (S)
  5. 46410Family a.23.2.1: Diol dehydratase, gamma subunit [47149] (1 protein)
  6. 46411Protein Diol dehydratase, gamma subunit [47150] (1 species)
  7. 46412Species Klebsiella oxytoca [TaxId:571] [47151] (4 PDB entries)
  8. 46419Domain d1diog_: 1dio G: [16496]
    Other proteins in same PDB: d1dioa_, d1diob_, d1dioe_, d1diol_

Details for d1diog_

PDB Entry: 1dio (more details), 2.2 Å

PDB Description: diol dehydratase-cyanocobalamin complex from klebsiella oxytoca

SCOP Domain Sequences for d1diog_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1diog_ a.23.2.1 (G:) Diol dehydratase, gamma subunit {Klebsiella oxytoca}
sarvsdyplankhpewvktatnktlddftlenvlsnkvtaqdmritpetlrlqasiakda
grdrlamnferaaeltavpddrileiynalrpyrstkeellaiaddlesryqakicaafv
reaatlyverkklkgdd

SCOP Domain Coordinates for d1diog_:

Click to download the PDB-style file with coordinates for d1diog_.
(The format of our PDB-style files is described here.)

Timeline for d1diog_: