Lineage for d2h68a_ (2h68 A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 960204Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 960290Superfamily b.69.4: WD40 repeat-like [50978] (3 families) (S)
    also contains 8-bladed propellers
  5. 960404Family b.69.4.0: automated matches [191412] (1 protein)
    not a true family
  6. 960405Protein automated matches [190568] (2 species)
    not a true protein
  7. 960406Species Human (Homo sapiens) [TaxId:9606] [187559] (26 PDB entries)
  8. 960415Domain d2h68a_: 2h68 A: [164958]
    automated match to d1vyhc1

Details for d2h68a_

PDB Entry: 2h68 (more details), 1.79 Å

PDB Description: Histone H3 recognition and presentation by the WDR5 module of the MLL1 complex
PDB Compounds: (A:) wd-repeat protein 5

SCOPe Domain Sequences for d2h68a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h68a_ b.69.4.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vkpnyalkftlaghtkavssvkfspngewlasssadklikiwgaydgkfektisghklgi
sdvawssdsnllvsasddktlkiwdvssgkclktlkghsnyvfccnfnpqsnlivsgsfd
esvriwdvktgkclktlpahsdpvsavhfnrdgslivsssydglcriwdtasgqclktli
dddnppvsfvkfspngkyilaatldntlklwdyskgkclktytghknekycifanfsvtg
gkwivsgsednlvyiwnlqtkeivqklqghtdvvistachpteniiasaalendktiklw
ksdc

SCOPe Domain Coordinates for d2h68a_:

Click to download the PDB-style file with coordinates for d2h68a_.
(The format of our PDB-style files is described here.)

Timeline for d2h68a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2h68b_