SCOPe 2.07: Domain d2h5za_: 2h5z A:

Lineage for d2h5za_ (2h5z A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.0: automated matches [191411] (1 protein)
   not a true family

6. Protein automated matches [190563] (18 species)
   not a true protein

7. Species House fly (Musca domestica) [TaxId:7370] [187696] (3 PDB entries)

8. Domain d2h5za_: 2h5z A: [164956]
   automated match to d1gd6a_
   complexed with cto

Details for d2h5za_

PDB Entry: 2h5z, 1.92 Å

PDB Description: crystallographic structure of digestive lysozyme 1 from musca domestica bound to chitotetraose at 1.92 a resolution

PDB Compounds: (A:) Lysozyme 1

SCOPe Domain Sequences for d2h5za_:

Sequence; same for both SEQRES and ATOM records:

>d2h5za_ d.2.1.0 (A:) automated matches {House fly (Musca domestica) [TaxId: 7370]}
ktftrcslaremyalgvpkselpqwtciaehessyrtnvvgptnsngsndygifqinnyy
wcqpsngrfsynechlscdalltdnisnsvtcarkiksqqgwtawstwkycsgslpsind
cf

Timeline for d2h5za_:

• d2h5za_ first appeared in SCOPe 2.01
  
• d2h5za_ appears in SCOPe 2.06
  
• d2h5za_ appears in the current release, SCOPe 2.08