SCOPe 2.01: Domain d2h5ob_: 2h5o B:

Lineage for d2h5ob_ (2h5o B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein automated matches [190406] (14 species)
   not a true protein

7. Species Coral (Discosoma sp.) [TaxId:86600] [188539] (17 PDB entries)

8. Domain d2h5ob_: 2h5o B: [164952]
   automated match to d1g7ka_
   complexed with mg

Details for d2h5ob_

PDB Entry: 2h5o, 1.08 Å

PDB Description: crystal structure of morange

PDB Compounds: (B:) mOrange

SCOPe Domain Sequences for d2h5ob_:

Sequence; same for both SEQRES and ATOM records:

>d2h5ob_ d.22.1.1 (B:) automated matches {Coral (Discosoma sp.) [TaxId: 86600]}
aiikefmrfkvrmegsvnghefeiegegegrpyegfqtaklkvtkggplpfawdilspqf
gygskayvkhpadipdyfklsfpegfkwervmnfedggvvtvtqdsslqdgefiykvklr
gtnfpsdgpvmqkktmgweassermypedgalkgeikmrlklkdgghytsevkttykakk
pvqlpgayivgiklditshnedytiveqyeraegrhs

Timeline for d2h5ob_:

• d2h5ob_ is new in SCOPe 2.01-stable
  
• d2h5ob_ appears in SCOPe 2.02
  
• d2h5ob_ appears in the current release, SCOPe 2.08