SCOPe 2.03: Domain d2h57c_: 2h57 C:

Lineage for d2h57c_ (2h57 C:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (58 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186862] (75 PDB entries)

8. Domain d2h57c_: 2h57 C: [164948]
   automated match to d1mr3f_
   complexed with gtp, mg, unx

Details for d2h57c_

PDB Entry: 2h57, 2 Å

PDB Description: crystal structure of human adp-ribosylation factor-like 6

PDB Compounds: (C:) ADP-ribosylation factor-like protein 6

SCOPe Domain Sequences for d2h57c_:

Sequence; same for both SEQRES and ATOM records:

>d2h57c_ c.37.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evhvlclgldnsgkttiinklkpsnaqsqnilptigfsiekfkssslsftvfdmsgqgry
rnlwehyykegqaiifvidssdrlrmvvakeeldtllnhpdikhrripilffankmdlrd
avtsvkvsqllclenikdkpwhicasdaikgeglqegvdwlqdqiq

Timeline for d2h57c_:

• d2h57c_ first appeared in SCOPe 2.01
  
• d2h57c_ appears in SCOPe 2.02
  
• d2h57c_ appears in SCOPe 2.04
  
• d2h57c_ appears in the current release, SCOPe 2.08