![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
![]() | Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) ![]() |
![]() | Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins) automatically mapped to Pfam PF00068 |
![]() | Protein automated matches [190139] (27 species) not a true protein |
![]() | Species Daboia russellii [TaxId:343250] [187787] (1 PDB entry) |
![]() | Domain d2h4ce_: 2h4c E: [164940] automated match to d1oqsa_ |
PDB Entry: 2h4c (more details), 2.6 Å
SCOPe Domain Sequences for d2h4ce_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h4ce_ a.133.1.2 (E:) automated matches {Daboia russellii [TaxId: 343250]} nffqfaemivkmtgkeavhsyaiygcycgwggqgkpqdatdrccfvhdccygtvndcnpk matysysfengdivcgdnnlclktvcecdraaaiclgqnvntydknyenyaishcteese qc
Timeline for d2h4ce_: