Lineage for d2h4ce_ (2h4c E:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2345955Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2345956Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2345961Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2346343Protein automated matches [190139] (27 species)
    not a true protein
  7. 2346416Species Daboia russellii [TaxId:343250] [187787] (1 PDB entry)
  8. 2346421Domain d2h4ce_: 2h4c E: [164940]
    automated match to d1oqsa_

Details for d2h4ce_

PDB Entry: 2h4c (more details), 2.6 Å

PDB Description: Structure of Daboiatoxin (heterodimeric PLA2 venom)
PDB Compounds: (E:) Phospholipase A2-III

SCOPe Domain Sequences for d2h4ce_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h4ce_ a.133.1.2 (E:) automated matches {Daboia russellii [TaxId: 343250]}
nffqfaemivkmtgkeavhsyaiygcycgwggqgkpqdatdrccfvhdccygtvndcnpk
matysysfengdivcgdnnlclktvcecdraaaiclgqnvntydknyenyaishcteese
qc

SCOPe Domain Coordinates for d2h4ce_:

Click to download the PDB-style file with coordinates for d2h4ce_.
(The format of our PDB-style files is described here.)

Timeline for d2h4ce_: