| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) ![]() |
| Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins) |
| Protein automated matches [190139] (19 species) not a true protein |
| Species Daboia russellii [TaxId:343250] [187787] (1 PDB entry) |
| Domain d2h4cd_: 2h4c D: [164939] automated match to d1oqsb_ |
PDB Entry: 2h4c (more details), 2.6 Å
SCOPe Domain Sequences for d2h4cd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h4cd_ a.133.1.2 (D:) automated matches {Daboia russellii [TaxId: 343250]}
nlfqfarlidakqeafsffkyisygcycgwggqgtpkdatdrccfvhdccyarvkgcnpk
lveysysyrtgkivcggddpclravcecdrvaaicfrenmntydkkymlysifdckeesd
qc
Timeline for d2h4cd_: