Lineage for d2h4ca_ (2h4c A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732915Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2732916Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2732921Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2733305Protein automated matches [190139] (27 species)
    not a true protein
  7. 2733378Species Daboia russellii [TaxId:343250] [187787] (1 PDB entry)
  8. 2733379Domain d2h4ca_: 2h4c A: [164936]
    automated match to d1oqsa_

Details for d2h4ca_

PDB Entry: 2h4c (more details), 2.6 Å

PDB Description: Structure of Daboiatoxin (heterodimeric PLA2 venom)
PDB Compounds: (A:) Phospholipase A2-III

SCOPe Domain Sequences for d2h4ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h4ca_ a.133.1.2 (A:) automated matches {Daboia russellii [TaxId: 343250]}
nffqfaemivkmtgkeavhsyaiygcycgwggqgkpqdatdrccfvhdccygtvndcnpk
matysysfengdivcgdnnlclktvcecdraaaiclgqnvntydknyenyaishcteese
qc

SCOPe Domain Coordinates for d2h4ca_:

Click to download the PDB-style file with coordinates for d2h4ca_.
(The format of our PDB-style files is described here.)

Timeline for d2h4ca_: