SCOPe 2.08: Domain d2h47c_: 2h47 C:

Lineage for d2h47c_ (2h47 C:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
   mono-domain proteins

6. Protein automated matches [190545] (9 species)
   not a true protein

7. Species Alcaligenes faecalis [TaxId:511] [187784] (4 PDB entries)

8. Domain d2h47c_: 2h47 C: [164932]
   Other proteins in same PDB: d2h47b_, d2h47e_, d2h47g_, d2h47i_
   automated match to d1dyza_
   complexed with cu

Details for d2h47c_

PDB Entry: 2h47, 2.6 Å

PDB Description: Crystal Structure of an Electron Transfer Complex Between Aromatic Amine Dephydrogenase and Azurin from Alcaligenes Faecalis (Form 1)

PDB Compounds: (C:) Azurin

SCOPe Domain Sequences for d2h47c_:

Sequence; same for both SEQRES and ATOM records:

>d2h47c_ b.6.1.1 (C:) automated matches {Alcaligenes faecalis [TaxId: 511]}
acdvsiegndsmqfntksivvdktckeftinlkhtgklpkaamghnvvvskksdesavat
dgmkaglnndyvkagderviahtsvigggetdsvtfdvsklkegedyaffcsfpghwsim
kgtielgs

Timeline for d2h47c_:

• d2h47c_ first appeared in SCOPe 2.01
  
• d2h47c_ appears in SCOPe 2.07