Lineage for d2h47b_ (2h47 B:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2585672Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
    disulfide-rich; nearly all-beta
  4. 2585673Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families) (S)
  5. 2585772Family g.21.1.0: automated matches [191380] (1 protein)
    not a true family
  6. 2585773Protein automated matches [190474] (1 species)
    not a true protein
  7. 2585774Species Alcaligenes faecalis [TaxId:511] [187398] (27 PDB entries)
  8. 2585827Domain d2h47b_: 2h47 B: [164931]
    Other proteins in same PDB: d2h47c_
    automated match to d1mg2b_
    complexed with cu

Details for d2h47b_

PDB Entry: 2h47 (more details), 2.6 Å

PDB Description: Crystal Structure of an Electron Transfer Complex Between Aromatic Amine Dephydrogenase and Azurin from Alcaligenes Faecalis (Form 1)
PDB Compounds: (B:) Aromatic amine dehydrogenase

SCOPe Domain Sequences for d2h47b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h47b_ g.21.1.0 (B:) automated matches {Alcaligenes faecalis [TaxId: 511]}
hislnpdlanedevnscdywrhcavdgflcsccggttttcppgstpspiswigtchnphd
gkdylisyhdccgktacgrcqcntqtrerpgyefflhndvnwcmanenstfhcttsvlvg
lakn

SCOPe Domain Coordinates for d2h47b_:

Click to download the PDB-style file with coordinates for d2h47b_.
(The format of our PDB-style files is described here.)

Timeline for d2h47b_: