Class g: Small proteins [56992] (90 folds) |
Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily) disulfide-rich; nearly all-beta |
Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families) |
Family g.21.1.0: automated matches [191380] (1 protein) not a true family |
Protein automated matches [190474] (1 species) not a true protein |
Species Alcaligenes faecalis [TaxId:511] [187398] (27 PDB entries) |
Domain d2h3xe_: 2h3x E: [164929] Other proteins in same PDB: d2h3xc_, d2h3xf_ automated match to d1mg2b_ complexed with cu |
PDB Entry: 2h3x (more details), 2.5 Å
SCOPe Domain Sequences for d2h3xe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h3xe_ g.21.1.0 (E:) automated matches {Alcaligenes faecalis [TaxId: 511]} dhislnpdlanedevnscdywrhcavdgflcsccggttttcppgstpspiswigtchnph dgkdylisyhdccgktacgrcqcntqtrerpgyefflhndvnwcmanenstfhcttsvlv glak
Timeline for d2h3xe_: