Lineage for d2h3ma1 (2h3m A:18-110)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2379659Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2379660Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2379661Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 2379973Protein automated matches [190055] (6 species)
    not a true protein
  7. 2379982Species Human (Homo sapiens) [TaxId:9606] [187785] (44 PDB entries)
  8. 2380038Domain d2h3ma1: 2h3m A:18-110 [164926]
    Other proteins in same PDB: d2h3ma2
    automated match to d2csja1
    complexed with so4

Details for d2h3ma1

PDB Entry: 2h3m (more details), 2.9 Å

PDB Description: crystal structure of zo-1 pdz1
PDB Compounds: (A:) Tight junction protein ZO-1

SCOPe Domain Sequences for d2h3ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h3ma1 b.36.1.1 (A:18-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iweqhtvtlhrapgfgfgiaisggrdnphfqsgetsivisdvlkggpaegqlqendrvam
vngvsmdnvehafavqqlrksgknakitirrkk

SCOPe Domain Coordinates for d2h3ma1:

Click to download the PDB-style file with coordinates for d2h3ma1.
(The format of our PDB-style files is described here.)

Timeline for d2h3ma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2h3ma2