Lineage for d2h30a_ (2h30 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2485379Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 2485567Protein Peptide methionine sulfoxide reductase MsrA/MsrB, N-terminal domain [142385] (2 species)
  7. 2485568Species Neisseria gonorrhoeae [TaxId:485] [187786] (1 PDB entry)
  8. 2485569Domain d2h30a_: 2h30 A: [164925]
    automated match to d2fy6a1

Details for d2h30a_

PDB Entry: 2h30 (more details), 1.6 Å

PDB Description: crystal structure of the n-terminal domain of pilb from neisseria gonorrhoeae
PDB Compounds: (A:) Peptide methionine sulfoxide reductase msrA/msrB

SCOPe Domain Sequences for d2h30a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h30a_ c.47.1.10 (A:) Peptide methionine sulfoxide reductase MsrA/MsrB, N-terminal domain {Neisseria gonorrhoeae [TaxId: 485]}
atvphtmstmktadnrpasvylkkdkptlikfwaswcplclselgqaekwaqdakfssan
litvaspgflhekkdgefqkwyaglnypklpvvtdnggtiaqnlnisvypswaligkdgd
vqrivkgsineaqalalirnpnadlgslkhs

SCOPe Domain Coordinates for d2h30a_:

Click to download the PDB-style file with coordinates for d2h30a_.
(The format of our PDB-style files is described here.)

Timeline for d2h30a_: