Lineage for d2h2ab_ (2h2a B:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1160658Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1160659Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 1160905Family c.26.1.3: Adenylyltransferase [52397] (6 proteins)
  6. 1160934Protein Nicotinamide mononucleotide (NMN) adenylyltransferase [52400] (7 species)
  7. 1161005Species Staphylococcus aureus [TaxId:1280] [187783] (2 PDB entries)
  8. 1161009Domain d2h2ab_: 2h2a B: [164923]
    automated match to d1kama_
    complexed with ca, dnd, gol

Details for d2h2ab_

PDB Entry: 2h2a (more details), 2.1 Å

PDB Description: Crystal structure of Nicotinic acid mononucleotide adenylyltransferase from Staphylococcus aureus: product bound form 2
PDB Compounds: (B:) Probable nicotinate-nucleotide adenylyltransferase

SCOPe Domain Sequences for d2h2ab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h2ab_ c.26.1.3 (B:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Staphylococcus aureus [TaxId: 1280]}
mkkivlyggqfnpihtahmivasevfhelqpdefyflpsfmsplkkhhdfidvqhrltmi
qmiidelgfgdicddeikrggqsytydtikafkeqhkdselyfvigtdqynqlekwyqie
ylkemvtfvvvnrdknsqnvenamiaiqiprvdisstmirqrvsegksiqvlvpksveny
ikgeglyeh

SCOPe Domain Coordinates for d2h2ab_:

Click to download the PDB-style file with coordinates for d2h2ab_.
(The format of our PDB-style files is described here.)

Timeline for d2h2ab_: