| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) ![]() |
| Family c.26.1.3: Adenylyltransferase [52397] (6 proteins) |
| Protein Nicotinamide mononucleotide (NMN) adenylyltransferase [52400] (8 species) |
| Species Staphylococcus aureus [TaxId:1280] [187783] (2 PDB entries) |
| Domain d2h2aa_: 2h2a A: [164922] automated match to d1kama_ complexed with ca, dnd, gol |
PDB Entry: 2h2a (more details), 2.1 Å
SCOPe Domain Sequences for d2h2aa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h2aa_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Staphylococcus aureus [TaxId: 1280]}
mkkivlyggqfnpihtahmivasevfhelqpdefyflpsfmsplkkhhdfidvqhrltmi
qmiidelgfgdicddeikrggqsytydtikafkeqhkdselyfvigtdqynqlekwyqie
ylkemvtfvvvnrdknsqnvenamiaiqiprvdisstmirqrvsegksiqvlvpksveny
ikgeglyeh
Timeline for d2h2aa_: