Lineage for d2h29a_ (2h29 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1841351Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1841352Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 1841638Family c.26.1.3: Adenylyltransferase [52397] (6 proteins)
  6. 1841667Protein Nicotinamide mononucleotide (NMN) adenylyltransferase [52400] (8 species)
  7. 1841745Species Staphylococcus aureus [TaxId:1280] [187783] (2 PDB entries)
  8. 1841746Domain d2h29a_: 2h29 A: [164920]
    automated match to d1kama_
    complexed with dnd

Details for d2h29a_

PDB Entry: 2h29 (more details), 2 Å

PDB Description: Crystal structure of Nicotinic acid mononucleotide Adenylyltransferase from Staphylococcus aureus: product bound form 1
PDB Compounds: (A:) Probable nicotinate-nucleotide adenylyltransferase

SCOPe Domain Sequences for d2h29a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h29a_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Staphylococcus aureus [TaxId: 1280]}
mkkivlyggqfnpihtahmivasevfhelqpdefyflpsfmsplkkhhdfidvqhrltmi
qmiidelgfgdicddeikrggqsytydtikafkeqhkdselyfvigtdqynqlekwyqie
ylkemvtfvvvnrdknsqnvenamiaiqiprvdisstmirqrvsegksiqvlvpksveny
ikgeglye

SCOPe Domain Coordinates for d2h29a_:

Click to download the PDB-style file with coordinates for d2h29a_.
(The format of our PDB-style files is described here.)

Timeline for d2h29a_: