Lineage for d1egvg_ (1egv G:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 46401Fold a.23: Open three-helical up-and-down bundle [47143] (4 superfamilies)
  4. 46409Superfamily a.23.2: Diol dehydratase, gamma subunit [47148] (1 family) (S)
  5. 46410Family a.23.2.1: Diol dehydratase, gamma subunit [47149] (1 protein)
  6. 46411Protein Diol dehydratase, gamma subunit [47150] (1 species)
  7. 46412Species Klebsiella oxytoca [TaxId:571] [47151] (4 PDB entries)
  8. 46415Domain d1egvg_: 1egv G: [16492]
    Other proteins in same PDB: d1egva_, d1egvb_, d1egve_, d1egvl_

Details for d1egvg_

PDB Entry: 1egv (more details), 1.75 Å

PDB Description: crystal structure of the diol dehydratase-adeninylpentylcobalamin complex from klebsella oxytoca under the illuminated condition.

SCOP Domain Sequences for d1egvg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1egvg_ a.23.2.1 (G:) Diol dehydratase, gamma subunit {Klebsiella oxytoca}
sarvsdyplankhpewvktatnktlddftlenvlsnkvtaqdmritpetlrlqasiakda
grdrlamnferaaeltavpddrileiynalrpyrstkeellaiaddlesryqakicaafv
reaatlyverkklkgdd

SCOP Domain Coordinates for d1egvg_:

Click to download the PDB-style file with coordinates for d1egvg_.
(The format of our PDB-style files is described here.)

Timeline for d1egvg_: