Lineage for d2h1xd_ (2h1x D:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2034780Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2035040Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) (S)
  5. 2035623Family b.3.4.0: automated matches [191441] (1 protein)
    not a true family
  6. 2035624Protein automated matches [190651] (7 species)
    not a true protein
  7. 2035657Species Zebrafish (Danio rerio) [TaxId:7955] [187781] (5 PDB entries)
  8. 2035673Domain d2h1xd_: 2h1x D: [164919]
    automated match to d1tfpa_

Details for d2h1xd_

PDB Entry: 2h1x (more details), 1.98 Å

PDB Description: Crystal structure of 5-hydroxyisourate Hydrolase (formerly known as TRP, Transthyretin Related Protein)
PDB Compounds: (D:) 5-hydroxyisourate Hydrolase (formerly known as TRP, Transthyretin Related Protein)

SCOPe Domain Sequences for d2h1xd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h1xd_ b.3.4.0 (D:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
splsthvlniaqgvpganmtivlhrldpvssawnilttgitnddgrcpglitkenfiagv
ykmrfetgkywdalgetcfypyveivftitntsqhyhvplllsrfsystyrgs

SCOPe Domain Coordinates for d2h1xd_:

Click to download the PDB-style file with coordinates for d2h1xd_.
(The format of our PDB-style files is described here.)

Timeline for d2h1xd_: