Class b: All beta proteins [48724] (174 folds) |
Fold b.3: Prealbumin-like [49451] (7 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) |
Family b.3.4.0: automated matches [191441] (1 protein) not a true family |
Protein automated matches [190651] (6 species) not a true protein |
Species Zebrafish (Danio rerio) [TaxId:7955] [187781] (5 PDB entries) |
Domain d2h1xb_: 2h1x B: [164917] automated match to d1tfpa_ |
PDB Entry: 2h1x (more details), 1.98 Å
SCOPe Domain Sequences for d2h1xb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h1xb_ b.3.4.0 (B:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]} splsthvlniaqgvpganmtivlhrldpvssawnilttgitnddgrcpglitkenfiagv ykmrfetgkywdalgetcfypyveivftitntsqhyhvplllsrfsystyrgs
Timeline for d2h1xb_: