SCOPe 2.01: Domain d2h1wa_: 2h1w A:

Lineage for d2h1wa_ (2h1w A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.92: Chelatase-like [53799] (3 superfamilies)
   duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.92.1: Chelatase [53800] (4 families)
   interdomain linker is short; swapping of C-terminal helices between the two domains

5. Family c.92.1.1: Ferrochelatase [53801] (2 proteins)

6. Protein Ferrochelatase [53802] (3 species)

7. Species Bacillus subtilis [TaxId:1423] [53803] (15 PDB entries)

8. Domain d2h1wa_: 2h1w A: [164915]
   automated match to d1doza_
   complexed with fe2, mg; mutant

Details for d2h1wa_

PDB Entry: 2h1w, 2.6 Å

PDB Description: crystal structure of the his183ala mutant variant of bacillus subtilis ferrochelatase

PDB Compounds: (A:) Ferrochelatase

SCOPe Domain Sequences for d2h1wa_:

Sequence; same for both SEQRES and ATOM records:

>d2h1wa_ c.92.1.1 (A:) Ferrochelatase {Bacillus subtilis [TaxId: 1423]}
srkkmgllvmaygtpykeedieryythirrgrkpepemlqdlkdryeaiggisplaqite
qqahnleqhlneiqdeitfkayiglkhiepfiedavaemhkdgiteavsivlaphfstfs
vqsynkrakeeaeklggltitsveswydepkfvtywvdrvketyasmpederenamlivs
aaslpekikefgdpypdqlhesakliaegagvseyavgwqsegntpdpwlgpdvqdltrd
lfeqkgyqafvyvpvgfvadhlevlydndyeckvvtddigasyyrpempnakpefidala
tvvlkklgr

Timeline for d2h1wa_:

• d2h1wa_ is new in SCOPe 2.01-stable
  
• d2h1wa_ appears in SCOPe 2.02
  
• d2h1wa_ appears in the current release, SCOPe 2.08