Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.92: Chelatase-like [53799] (3 superfamilies) duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.92.1: Chelatase [53800] (4 families) interdomain linker is short; swapping of C-terminal helices between the two domains |
Family c.92.1.1: Ferrochelatase [53801] (2 proteins) |
Protein Ferrochelatase [53802] (3 species) |
Species Bacillus subtilis [TaxId:1423] [53803] (15 PDB entries) |
Domain d2h1wa_: 2h1w A: [164915] automated match to d1doza_ complexed with fe2, mg; mutant |
PDB Entry: 2h1w (more details), 2.6 Å
SCOPe Domain Sequences for d2h1wa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h1wa_ c.92.1.1 (A:) Ferrochelatase {Bacillus subtilis [TaxId: 1423]} srkkmgllvmaygtpykeedieryythirrgrkpepemlqdlkdryeaiggisplaqite qqahnleqhlneiqdeitfkayiglkhiepfiedavaemhkdgiteavsivlaphfstfs vqsynkrakeeaeklggltitsveswydepkfvtywvdrvketyasmpederenamlivs aaslpekikefgdpypdqlhesakliaegagvseyavgwqsegntpdpwlgpdvqdltrd lfeqkgyqafvyvpvgfvadhlevlydndyeckvvtddigasyyrpempnakpefidala tvvlkklgr
Timeline for d2h1wa_: