Lineage for d2h1wa_ (2h1w A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2912237Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2912238Superfamily c.92.1: Chelatase [53800] (4 families) (S)
    interdomain linker is short; swapping of C-terminal helices between the two domains
  5. 2912239Family c.92.1.1: Ferrochelatase [53801] (2 proteins)
    automatically mapped to Pfam PF00762
  6. 2912240Protein Ferrochelatase [53802] (3 species)
  7. 2912241Species Bacillus subtilis [TaxId:1423] [53803] (16 PDB entries)
  8. 2912256Domain d2h1wa_: 2h1w A: [164915]
    automated match to d1doza_
    complexed with fe2, mg; mutant

Details for d2h1wa_

PDB Entry: 2h1w (more details), 2.6 Å

PDB Description: crystal structure of the his183ala mutant variant of bacillus subtilis ferrochelatase
PDB Compounds: (A:) Ferrochelatase

SCOPe Domain Sequences for d2h1wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h1wa_ c.92.1.1 (A:) Ferrochelatase {Bacillus subtilis [TaxId: 1423]}
srkkmgllvmaygtpykeedieryythirrgrkpepemlqdlkdryeaiggisplaqite
qqahnleqhlneiqdeitfkayiglkhiepfiedavaemhkdgiteavsivlaphfstfs
vqsynkrakeeaeklggltitsveswydepkfvtywvdrvketyasmpederenamlivs
aaslpekikefgdpypdqlhesakliaegagvseyavgwqsegntpdpwlgpdvqdltrd
lfeqkgyqafvyvpvgfvadhlevlydndyeckvvtddigasyyrpempnakpefidala
tvvlkklgr

SCOPe Domain Coordinates for d2h1wa_:

Click to download the PDB-style file with coordinates for d2h1wa_.
(The format of our PDB-style files is described here.)

Timeline for d2h1wa_: