Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (21 families) consists only of helices |
Family a.4.1.0: automated matches [191447] (1 protein) not a true family |
Protein automated matches [190674] (25 species) not a true protein |
Species Golden hamster (Mesocricetus auratus) [TaxId:10036] [187780] (1 PDB entry) |
Domain d2h1kb_: 2h1k B: [164913] automated match to d1ahdp_ protein/DNA complex |
PDB Entry: 2h1k (more details), 2.42 Å
SCOPe Domain Sequences for d2h1kb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h1kb_ a.4.1.0 (B:) automated matches {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} nkrtrtaytraqllelekeflfnkyisrprrvelavmlnlterhikiwfqnrrmkwkkee
Timeline for d2h1kb_: