Lineage for d2h1ab_ (2h1a B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 991973Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 991974Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 992926Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 993133Protein Thiol-disulfide oxidoreductase ResA [102455] (1 species)
  7. 993134Species Bacillus subtilis [TaxId:1423] [102456] (7 PDB entries)
  8. 993148Domain d2h1ab_: 2h1a B: [164907]
    automated match to d1st9a_
    complexed with edo

Details for d2h1ab_

PDB Entry: 2h1a (more details), 2.4 Å

PDB Description: resa c74a variant
PDB Compounds: (B:) Thiol-disulfide oxidoreductase resA

SCOPe Domain Sequences for d2h1ab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h1ab_ c.47.1.10 (B:) Thiol-disulfide oxidoreductase ResA {Bacillus subtilis [TaxId: 1423]}
sdapnfvledtngkrielsdlkgkgvflnfwgtwaepckkefpymanqykhfksqgveiv
avnvgeskiavhnfmksygvnfpvvldtdrqvldaydvsplpttflinpegkvvkvvtgt
mtesmihdymnlikpgets

SCOPe Domain Coordinates for d2h1ab_:

Click to download the PDB-style file with coordinates for d2h1ab_.
(The format of our PDB-style files is described here.)

Timeline for d2h1ab_: